SCOPe 2.04: Domain d3s14e1: 3s14 E:2-143

Lineage for d3s14e1 (3s14 E:2-143)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.3: Eukaryotic RPB5 N-terminal domain [53036] (1 family)

5. Family c.52.3.1: Eukaryotic RPB5 N-terminal domain [53037] (2 proteins)

6. Protein Eukaryotic RPB5 N-terminal domain [53038] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [224894] (1 PDB entry)

8. Domain d3s14e1: 3s14 E:2-143 [216146]
   Other proteins in same PDB: d3s14a_, d3s14b_, d3s14c1, d3s14c2, d3s14e2, d3s14f_, d3s14h_, d3s14i1, d3s14i2, d3s14j_, d3s14k_, d3s14l_
   automated match to d1twfe1
   protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d3s14e1

PDB Entry: 3s14, 2.85 Å

PDB Description: rna polymerase ii initiation complex with a 6-nt rna

PDB Compounds: (E:) DNA-directed RNA polymerases I, II, and III subunit RPABC1

SCOPe Domain Sequences for d3s14e1:

Sequence; same for both SEQRES and ATOM records:

>d3s14e1 c.52.3.1 (E:2-143) Eukaryotic RPB5 N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
dqenernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdsmgrpqrkmmsfq
anpteesiskfpdmgslwvefcdepsvgvktmktfvihiqeknfqtgifvyqnnitpsam
klvpsippatietfneaalvvn

Timeline for d3s14e1:

• d3s14e1 first appeared in SCOPe 2.03
  
• d3s14e1 appears in SCOPe 2.05
  
• d3s14e1 appears in the current release, SCOPe 2.08