![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily) unusual fold; contains a left-handed beta-alpha-beta unit |
![]() | Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) ![]() automatically mapped to Pfam PF01000 |
![]() | Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (3 proteins) |
![]() | Protein RPB3 [64462] (2 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [224943] (1 PDB entry) |
![]() | Domain d3s14c2: 3s14 C:42-172 [216145] Other proteins in same PDB: d3s14a_, d3s14b_, d3s14c1, d3s14e1, d3s14e2, d3s14f_, d3s14h_, d3s14i1, d3s14i2, d3s14j_, d3s14k_, d3s14l_ automated match to d1twfc2 protein/DNA complex; protein/RNA complex; complexed with mg, zn |
PDB Entry: 3s14 (more details), 2.85 Å
SCOPe Domain Sequences for d3s14c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3s14c2 d.181.1.1 (C:42-172) RPB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} ptlaidsvevetnttvladefiahrlgliplqsmdieqleysrdcfcedhcdkcsvvltl qafgesesttnvyskdlvivsnlmgrnighpiiqdkegngvlicklrkgqelkltcvakk giakehakwgp
Timeline for d3s14c2: