Lineage for d3s14c2 (3s14 C:42-172)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1684390Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
    unusual fold; contains a left-handed beta-alpha-beta unit
  4. 1684391Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) (S)
    automatically mapped to Pfam PF01000
  5. 1684392Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (2 proteins)
  6. 1684463Protein RPB3 [64462] (2 species)
  7. 1684490Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [224943] (1 PDB entry)
  8. 1684491Domain d3s14c2: 3s14 C:42-172 [216145]
    Other proteins in same PDB: d3s14a_, d3s14b_, d3s14c1, d3s14e1, d3s14e2, d3s14f_, d3s14h_, d3s14i1, d3s14i2, d3s14j_, d3s14k_, d3s14l_
    automated match to d1twfc2
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d3s14c2

PDB Entry: 3s14 (more details), 2.85 Å

PDB Description: rna polymerase ii initiation complex with a 6-nt rna
PDB Compounds: (C:) DNA-directed RNA polymerase II subunit RPB3

SCOPe Domain Sequences for d3s14c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s14c2 d.181.1.1 (C:42-172) RPB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ptlaidsvevetnttvladefiahrlgliplqsmdieqleysrdcfcedhcdkcsvvltl
qafgesesttnvyskdlvivsnlmgrnighpiiqdkegngvlicklrkgqelkltcvakk
giakehakwgp

SCOPe Domain Coordinates for d3s14c2:

Click to download the PDB-style file with coordinates for d3s14c2.
(The format of our PDB-style files is described here.)

Timeline for d3s14c2: