Lineage for d3s14c1 (3s14 C:3-41,C:173-268)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2564740Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 2564876Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) (S)
    form homo and heterodimers
  5. 2564877Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (3 proteins)
  6. 2564957Protein RPB3 [64315] (2 species)
  7. 2564984Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [224933] (1 PDB entry)
  8. 2564985Domain d3s14c1: 3s14 C:3-41,C:173-268 [216144]
    Other proteins in same PDB: d3s14a_, d3s14b_, d3s14c2, d3s14e1, d3s14e2, d3s14f_, d3s14h_, d3s14i1, d3s14i2, d3s14j_, d3s14k_, d3s14l_
    automated match to d1twfc1
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d3s14c1

PDB Entry: 3s14 (more details), 2.85 Å

PDB Description: rna polymerase ii initiation complex with a 6-nt rna
PDB Compounds: (C:) DNA-directed RNA polymerase II subunit RPB3

SCOPe Domain Sequences for d3s14c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s14c1 d.74.3.1 (C:3-41,C:173-268) RPB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
eegpqvkireaskdnvdfilsnvdlamanslrrvmiaeiXaaaiefeydpwnklkhtdyw
yeqdsakewpqsknceyedppnegdpfdykaqadtfymnvesvgsipvdqvvvrgidtlq
kkvasillaltqmdqd

SCOPe Domain Coordinates for d3s14c1:

Click to download the PDB-style file with coordinates for d3s14c1.
(The format of our PDB-style files is described here.)

Timeline for d3s14c1: