![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
![]() | Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) ![]() |
![]() | Family d.157.1.0: automated matches [191360] (1 protein) not a true family |
![]() | Protein automated matches [190418] (18 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [226145] (7 PDB entries) |
![]() | Domain d3s0za_: 3s0z A: [216140] automated match to d3rkka_ complexed with zn |
PDB Entry: 3s0z (more details), 2.5 Å
SCOPe Domain Sequences for d3s0za_:
Sequence, based on SEQRES records: (download)
>d3s0za_ d.157.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]} gdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqtaqilnwik qeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqhsltfaan gwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgnlgdadt ehyaasarafgaafpkasmivmshsapdsraaithtarmadklr
>d3s0za_ d.157.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]} gdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqtaqilnwik qeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqhsltfaan patapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgnlgdadtehya asarafgaafpkasmivmshsapdsraaithtarmadklr
Timeline for d3s0za_: