SCOP 1.57: Domain d1hqrb1: 1hqr B:293-390

Lineage for d1hqrb1 (1hqr B:293-390)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (10 species)

7. Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [49135] (3 PDB entries)

8. Domain d1hqrb1: 1hqr B:293-390 [21614]
   Other proteins in same PDB: d1hqra2, d1hqrb2, d1hqrd1, d1hqrd2

Details for d1hqrb1

PDB Entry: 1hqr, 3.2 Å

PDB Description: crystal structure of a superantigen bound to the high-affinity, zinc-dependent site on mhc class ii

SCOP Domain Sequences for d1hqrb1:

Sequence, based on SEQRES records:

>d1hqrb1 b.1.1.2 (B:293-390) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR2}
rrvepkvtvypartqtlqhhnllvcsvngfypgsievrwfrnsqeekagvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewra

Sequence, based on observed residues (ATOM records):

>d1hqrb1 b.1.1.2 (B:293-390) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR2}
rrvepkvtvypahnllvcsvngfypgsievrwfrnsqeekagvvstgliqngdwtfqtlv
mletvprevytcqvehpsvtspltvewra

Timeline for d1hqrb1:

• d1hqrb1 first appeared (with stable ids) in SCOP 1.55
  
• d1hqrb1 appears in SCOP 1.59
  
• d1hqrb1 appears in the current release, SCOPe 2.08