Lineage for d1hqrb1 (1hqr B:293-390)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 53149Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (10 species)
  7. 53179Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [49135] (3 PDB entries)
  8. 53189Domain d1hqrb1: 1hqr B:293-390 [21614]
    Other proteins in same PDB: d1hqra2, d1hqrb2, d1hqrd1, d1hqrd2

Details for d1hqrb1

PDB Entry: 1hqr (more details), 3.2 Å

PDB Description: crystal structure of a superantigen bound to the high-affinity, zinc-dependent site on mhc class ii

SCOP Domain Sequences for d1hqrb1:

Sequence, based on SEQRES records: (download)

>d1hqrb1 b.1.1.2 (B:293-390) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR2}
rrvepkvtvypartqtlqhhnllvcsvngfypgsievrwfrnsqeekagvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewra

Sequence, based on observed residues (ATOM records): (download)

>d1hqrb1 b.1.1.2 (B:293-390) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR2}
rrvepkvtvypahnllvcsvngfypgsievrwfrnsqeekagvvstgliqngdwtfqtlv
mletvprevytcqvehpsvtspltvewra

SCOP Domain Coordinates for d1hqrb1:

Click to download the PDB-style file with coordinates for d1hqrb1.
(The format of our PDB-style files is described here.)

Timeline for d1hqrb1: