| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.224: Glycolipid transfer protein, GLTP [110003] (1 superfamily) multihelical; 2 layers or orthogonally packed helices |
Superfamily a.224.1: Glycolipid transfer protein, GLTP [110004] (1 family) ![]() |
| Family a.224.1.1: Glycolipid transfer protein, GLTP [110005] (2 proteins) |
| Protein Glycolipid transfer protein, GLTP [110006] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [110007] (20 PDB entries) Uniprot Q9NZD2 |
| Domain d3s0ka_: 3s0k A: [216138] automated match to d1sx6a_ complexed with 03f, ni |
PDB Entry: 3s0k (more details), 1.4 Å
SCOPe Domain Sequences for d3s0ka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3s0ka_ a.224.1.1 (A:) Glycolipid transfer protein, GLTP {Human (Homo sapiens) [TaxId: 9606]}
hllkplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavydtnpak
frtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenhpnlirv
natkayemalkkyhgwivqkifqaalyaapyksdflkalskgqnvteeeclekirlflvn
ytatidviyemytqmnaelnykv
Timeline for d3s0ka_: