Lineage for d3s0ia_ (3s0i A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2737813Fold a.224: Glycolipid transfer protein, GLTP [110003] (1 superfamily)
    multihelical; 2 layers or orthogonally packed helices
  4. 2737814Superfamily a.224.1: Glycolipid transfer protein, GLTP [110004] (1 family) (S)
  5. 2737815Family a.224.1.1: Glycolipid transfer protein, GLTP [110005] (2 proteins)
  6. 2737816Protein Glycolipid transfer protein, GLTP [110006] (2 species)
  7. 2737819Species Human (Homo sapiens) [TaxId:9606] [110007] (20 PDB entries)
    Uniprot Q9NZD2
  8. 2737824Domain d3s0ia_: 3s0i A: [216137]
    automated match to d2evta_
    complexed with cis; mutant

Details for d3s0ia_

PDB Entry: 3s0i (more details), 1.5 Å

PDB Description: Crystal Structure of D48V mutant of Human Glycolipid Transfer Protein complexed with 3-O-sulfo galactosylceramide containing nervonoyl acyl chain
PDB Compounds: (A:) glycolipid transfer protein

SCOPe Domain Sequences for d3s0ia_:

Sequence, based on SEQRES records: (download)

>d3s0ia_ a.224.1.1 (A:) Glycolipid transfer protein, GLTP {Human (Homo sapiens) [TaxId: 9606]}
llkplpadkqietgpfleavshlppffdclgspvftpikavisgnitkikavydtnpakf
rtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenhpnlirvn
atkayemalkkyhgwivqkifqaalyaapyksdflkalskgqnvteeeclekirlflvny
tatidviyemytqmnaelnykv

Sequence, based on observed residues (ATOM records): (download)

>d3s0ia_ a.224.1.1 (A:) Glycolipid transfer protein, GLTP {Human (Homo sapiens) [TaxId: 9606]}
llkplpadkqietgpfleavshlppffdclgspvftpikavisgnitkikavydtnpakf
rtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenhpnlirvn
atkayemalkkyhgwivqkifqaalyaapyksdflkalskgnvteeeclekirlflvnyt
atidviyemytqmnaelnykv

SCOPe Domain Coordinates for d3s0ia_:

Click to download the PDB-style file with coordinates for d3s0ia_.
(The format of our PDB-style files is described here.)

Timeline for d3s0ia_: