SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3rz3c_ (3rz3 C:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2164133Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2164134Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2164520Family d.20.1.0: automated matches [191322] (1 protein)
    not a true family
  6. 2164521Protein automated matches [190120] (7 species)
    not a true protein
  7. 2164526Species Human (Homo sapiens) [TaxId:9606] [186843] (17 PDB entries)
  8. 2164535Domain d3rz3c_: 3rz3 C: [216131]
    Other proteins in same PDB: d3rz3a2, d3rz3b2
    automated match to d2cyxa_
    complexed with u94

Details for d3rz3c_

PDB Entry: 3rz3 (more details), 2.3 Å

PDB Description: Human Cdc34 E2 in complex with CC0651 inhibitor
PDB Compounds: (C:) Ubiquitin-conjugating enzyme E2 R1

SCOPe Domain Sequences for d3rz3c_:

Sequence, based on SEQRES records: (download)

>d3rz3c_ d.20.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sqkalllelkglqeepvegfrvtlvdegdlynwevaifgppntyyeggyfkarlkfpidy
pysppafrfltkmwhpniyetgdvcisilhppvddpqsgelpserwnptqnvrtillsvi
sllnepntfspanvdasvmyrkwkeskgkdreytdiirkqvlgtkvdaerdgvk

Sequence, based on observed residues (ATOM records): (download)

>d3rz3c_ d.20.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sqkalllelkglqeepvegfrvtlvdegdlynwevaifgppntyyeggyfkarlkfpidy
pysppafrfltkmwhpniyetgdvcirwnptqnvrtillsvisllnepntfspanvdasv
myrkwkeskgkdreytdiirkqvlgtkvdaerdgvk

SCOPe Domain Coordinates for d3rz3c_:

Click to download the PDB-style file with coordinates for d3rz3c_.
(The format of our PDB-style files is described here.)

Timeline for d3rz3c_: