SCOPe 2.08: Domain d3rz3c_: 3rz3 C:

Lineage for d3rz3c_ (3rz3 C:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.0: automated matches [191322] (1 protein)
   not a true family

6. Protein automated matches [190120] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186843] (28 PDB entries)

8. Domain d3rz3c_: 3rz3 C: [216131]
   Other proteins in same PDB: d3rz3a2, d3rz3b2
   automated match to d2cyxa_
   complexed with u94

Details for d3rz3c_

PDB Entry: 3rz3, 2.3 Å

PDB Description: Human Cdc34 E2 in complex with CC0651 inhibitor

PDB Compounds: (C:) Ubiquitin-conjugating enzyme E2 R1

SCOPe Domain Sequences for d3rz3c_:

Sequence, based on SEQRES records:

>d3rz3c_ d.20.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sqkalllelkglqeepvegfrvtlvdegdlynwevaifgppntyyeggyfkarlkfpidy
pysppafrfltkmwhpniyetgdvcisilhppvddpqsgelpserwnptqnvrtillsvi
sllnepntfspanvdasvmyrkwkeskgkdreytdiirkqvlgtkvdaerdgvk

Sequence, based on observed residues (ATOM records):

>d3rz3c_ d.20.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sqkalllelkglqeepvegfrvtlvdegdlynwevaifgppntyyeggyfkarlkfpidy
pysppafrfltkmwhpniyetgdvcirwnptqnvrtillsvisllnepntfspanvdasv
myrkwkeskgkdreytdiirkqvlgtkvdaerdgvk

Timeline for d3rz3c_:

• d3rz3c_ first appeared in SCOPe 2.03
  
• d3rz3c_ appears in SCOPe 2.07