Lineage for d1hqra1 (1hqr A:82-181)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 931881Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 933034Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)
  7. 933042Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (29 PDB entries)
    Uniprot P01903 28-207
    probably orthologous to the mouse I-E group
  8. 933080Domain d1hqra1: 1hqr A:82-181 [21613]
    Other proteins in same PDB: d1hqra2, d1hqrb1, d1hqrb2, d1hqrd1, d1hqrd2
    complexed with zn

Details for d1hqra1

PDB Entry: 1hqr (more details), 3.2 Å

PDB Description: crystal structure of a superantigen bound to the high-affinity, zinc-dependent site on mhc class ii
PDB Compounds: (A:) hla-dr alpha chain

SCOPe Domain Sequences for d1hqra1:

Sequence, based on SEQRES records: (download)

>d1hqra1 b.1.1.2 (A:82-181) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefd

Sequence, based on observed residues (ATOM records): (download)

>d1hqra1 b.1.1.2 (A:82-181) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvtgvsetvflpred
hlfrkfhylpflpstedvydcrvehwgldepllkhwefd

SCOPe Domain Coordinates for d1hqra1:

Click to download the PDB-style file with coordinates for d1hqra1.
(The format of our PDB-style files is described here.)

Timeline for d1hqra1: