| Class b: All beta proteins [48724] (141 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
| Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species) |
| Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (25 PDB entries) probably orthologous to the mouse I-E group |
| Domain d1hqra1: 1hqr A:82-181 [21613] Other proteins in same PDB: d1hqra2, d1hqrb1, d1hqrb2, d1hqrd1, d1hqrd2 complexed with zn |
PDB Entry: 1hqr (more details), 3.2 Å
SCOP Domain Sequences for d1hqra1:
Sequence, based on SEQRES records: (download)
>d1hqra1 b.1.1.2 (A:82-181) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefd
>d1hqra1 b.1.1.2 (A:82-181) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvtgvsetvflpred
hlfrkfhylpflpstedvydcrvehwgldepllkhwefd
Timeline for d1hqra1:
View in 3DDomains from other chains: (mouse over for more information) d1hqrb1, d1hqrb2, d1hqrd1, d1hqrd2 |