Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (12 species) |
Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [49135] (3 PDB entries) |
Domain d1hqra1: 1hqr A:82-181 [21613] Other proteins in same PDB: d1hqra2, d1hqrb2, d1hqrd1, d1hqrd2 |
PDB Entry: 1hqr (more details), 3.2 Å
SCOP Domain Sequences for d1hqra1:
Sequence, based on SEQRES records: (download)
>d1hqra1 b.1.1.2 (A:82-181) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR2} itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre dhlfrkfhylpflpstedvydcrvehwgldepllkhwefd
>d1hqra1 b.1.1.2 (A:82-181) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR2} itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvtgvsetvflpred hlfrkfhylpflpstedvydcrvehwgldepllkhwefd
Timeline for d1hqra1:
View in 3D Domains from other chains: (mouse over for more information) d1hqrb1, d1hqrb2, d1hqrd1, d1hqrd2 |