Lineage for d3rz2b_ (3rz2 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2875105Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2875106Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2875107Family c.45.1.1: Dual specificity phosphatase-like [52800] (9 proteins)
  6. 2875165Protein automated matches [190696] (6 species)
    not a true protein
  7. 2875250Species Norway rat (Rattus norvegicus) [TaxId:10116] [225022] (2 PDB entries)
  8. 2875252Domain d3rz2b_: 3rz2 B: [216128]
    automated match to d1v3aa_

Details for d3rz2b_

PDB Entry: 3rz2 (more details), 2.8 Å

PDB Description: Crystal of Prl-1 complexed with peptide
PDB Compounds: (B:) Protein tyrosine phosphatase type IVA 1

SCOPe Domain Sequences for d3rz2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rz2b_ c.45.1.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pvevtyknmrflithnptnatlnkfieelkkygvttivrvceatydttlvekegihvldw
pfddgappsnqivddwlslvkikfreepgcciavhcvaglgrapvlvalalieggmkyed
avqfirqkrrgafnskqllylekyrpkmrlrf

SCOPe Domain Coordinates for d3rz2b_:

Click to download the PDB-style file with coordinates for d3rz2b_.
(The format of our PDB-style files is described here.)

Timeline for d3rz2b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3rz2a_