| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423 |
Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) ![]() share with the family I the common active site structure with a circularly permuted topology |
| Family c.45.1.1: Dual specificity phosphatase-like [52800] (9 proteins) |
| Protein automated matches [190696] (6 species) not a true protein |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [225022] (2 PDB entries) |
| Domain d3rz2a_: 3rz2 A: [216127] automated match to d1v3aa_ |
PDB Entry: 3rz2 (more details), 2.8 Å
SCOPe Domain Sequences for d3rz2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rz2a_ c.45.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pvevtyknmrflithnptnatlnkfieelkkygvttivrvceatydttlvekegihvldw
pfddgappsnqivddwlslvkikfreepgcciavhcvaglgrapvlvalalieggmkyed
avqfirqkrrgafnskqllylekyrpkmrlrf
Timeline for d3rz2a_: