![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.4: CAP C-terminal domain-like [46796] (9 proteins) |
![]() | Protein Catabolite gene activator protein (CAP), C-terminal domain [46797] (1 species) N-terminal domain has double beta-helix fold |
![]() | Species Escherichia coli [TaxId:562] [46798] (28 PDB entries) |
![]() | Domain d3rypa2: 3ryp A:138-207 [216120] Other proteins in same PDB: d3rypa1, d3rypb1 automated match to d1g6nb1 complexed with cmp, gol |
PDB Entry: 3ryp (more details), 1.6 Å
SCOPe Domain Sequences for d3rypa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rypa2 a.4.5.4 (A:138-207) Catabolite gene activator protein (CAP), C-terminal domain {Escherichia coli [TaxId: 562]} dvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilkmledqnlis ahgktivvyg
Timeline for d3rypa2: