SCOP 1.55: Domain d1bx2e1: 1bx2 E:93-191

Lineage for d1bx2e1 (1bx2 E:93-191)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (9 species)

7. Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [49135] (3 PDB entries)

8. Domain d1bx2e1: 1bx2 E:93-191 [21612]
   Other proteins in same PDB: d1bx2a2, d1bx2b2, d1bx2d2, d1bx2e2

Details for d1bx2e1

PDB Entry: 1bx2, 2.6 Å

PDB Description: crystal structure of hla-dr2 (dra*0101,drb1*1501) complexed with a peptide from human myelin basic protein

SCOP Domain Sequences for d1bx2e1:

Sequence; same for both SEQRES and ATOM records:

>d1bx2e1 b.1.1.2 (E:93-191) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR2}
rrvqpkvtvypsktqplqhhnllvcsvsgfypgsievrwflngqeekagmvstgliqngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewrar

Timeline for d1bx2e1:

• d1bx2e1 appears in SCOP 1.57
  
• d1bx2e1 appears in the current release, SCOPe 2.08