SCOPe 2.03: Domain d3rykb_: 3ryk B:

Lineage for d3rykb_ (3ryk B:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.0: automated matches [191354] (1 protein)
   not a true family

6. Protein automated matches [190388] (15 species)
   not a true protein

7. Species Bacillus anthracis [TaxId:198094] [226138] (1 PDB entry)

8. Domain d3rykb_: 3ryk B: [216118]
   automated match to d2ixla_
   complexed with pop, tyd

Details for d3rykb_

PDB Entry: 3ryk, 1.63 Å

PDB Description: 1.63 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase (rfbc) from bacillus anthracis str. ames with tdp and ppi bound

PDB Compounds: (B:) dtdp-4-dehydrorhamnose 3,5-epimerase

SCOPe Domain Sequences for d3rykb_:

Sequence; same for both SEQRES and ATOM records:

>d3rykb_ b.82.1.0 (B:) automated matches {Bacillus anthracis [TaxId: 198094]}
amkvietnftdaklleprlfgddrgfftesynkkvletlgvthsfvqdnvsysaeagtir
glhfqknpkaqtkliqvmqgaiydvivdlrkdsptfkqwrgyilsadnhrqllvpkgfah
gfctlvphtivmykvdeyysadhdsgvlwndkelaipwpvtspilsdkdrilpll

Timeline for d3rykb_:

• d3rykb_ is new in SCOPe 2.03-stable
  
• d3rykb_ appears in SCOPe 2.04
  
• d3rykb_ appears in the current release, SCOPe 2.08, called d3rykb1