SCOPe 2.06: Domain d3ryka1: 3ryk A:1-174

Lineage for d3ryka1 (3ryk A:1-174)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.0: automated matches [191354] (1 protein)
   not a true family

6. Protein automated matches [190388] (23 species)
   not a true protein

7. Species Bacillus anthracis [TaxId:198094] [226138] (1 PDB entry)

8. Domain d3ryka1: 3ryk A:1-174 [216117]
   Other proteins in same PDB: d3ryka2, d3rykb2
   automated match to d2ixla_
   complexed with pop, tyd

Details for d3ryka1

PDB Entry: 3ryk, 1.63 Å

PDB Description: 1.63 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase (rfbc) from bacillus anthracis str. ames with tdp and ppi bound

PDB Compounds: (A:) dtdp-4-dehydrorhamnose 3,5-epimerase

SCOPe Domain Sequences for d3ryka1:

Sequence; same for both SEQRES and ATOM records:

>d3ryka1 b.82.1.0 (A:1-174) automated matches {Bacillus anthracis [TaxId: 198094]}
mkvietnftdaklleprlfgddrgfftesynkkvletlgvthsfvqdnvsysaeagtirg
lhfqknpkaqtkliqvmqgaiydvivdlrkdsptfkqwrgyilsadnhrqllvpkgfahg
fctlvphtivmykvdeyysadhdsgvlwndkelaipwpvtspilsdkdrilpll

Timeline for d3ryka1:

• d3ryka1 first appeared in SCOPe 2.03, called d3ryka_
  
• d3ryka1 was called d3ryka_ in SCOPe 2.05
  
• d3ryka1 appears in SCOPe 2.07
  
• d3ryka1 appears in the current release, SCOPe 2.08