Lineage for d3rx2a1 (3rx2 A:0-315)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2437818Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2437819Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
    Common fold covers whole protein structure
  6. 2437883Protein Aldose reductase (aldehyde reductase) [51436] (2 species)
  7. 2437884Species Human (Homo sapiens) [TaxId:9606] [51437] (155 PDB entries)
    Uniprot P15121
  8. 2437991Domain d3rx2a1: 3rx2 A:0-315 [216108]
    Other proteins in same PDB: d3rx2a2
    automated match to d3caqb_
    complexed with nap, slo

Details for d3rx2a1

PDB Entry: 3rx2 (more details), 1.9 Å

PDB Description: Crystal Structure of Human Aldose Reductase Complexed with Sulindac Sulfone
PDB Compounds: (A:) aldose reductase

SCOPe Domain Sequences for d3rx2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rx2a1 c.1.7.1 (A:0-315) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]}
masrlllnngakmpilglgtwksppgqvteavkvaidvgyrhidcahvyqnenevgvaiq
eklreqvvkreelfivsklwctyhekglvkgacqktlsdlkldyldlylihwptgfkpgk
effpldesgnvvpsdtnildtwaameelvdeglvkaigisnfnhlqvemilnkpglkykp
avnqiechpyltqekliqycqskgivvtaysplgspdrpwakpedpslledprikaiaak
hnkttaqvlirfpmqrnlvvipksvtperiaenfkvfdfelssqdmttllsynrnwrvca
llsctshkdypfheef

SCOPe Domain Coordinates for d3rx2a1:

Click to download the PDB-style file with coordinates for d3rx2a1.
(The format of our PDB-style files is described here.)

Timeline for d3rx2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3rx2a2