SCOPe 2.08: Domain d3rwvb_: 3rwv B:

Lineage for d3rwvb_ (3rwv B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.224: Glycolipid transfer protein, GLTP [110003] (1 superfamily)
   multihelical; 2 layers or orthogonally packed helices

4. Superfamily a.224.1: Glycolipid transfer protein, GLTP [110004] (1 family)

5. Family a.224.1.1: Glycolipid transfer protein, GLTP [110005] (2 proteins)

6. Protein Glycolipid transfer protein, GLTP [110006] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [110007] (20 PDB entries)
   Uniprot Q9NZD2

8. Domain d3rwvb_: 3rwv B: [216107]
   automated match to d4gixa_
   complexed with so4

Details for d3rwvb_

PDB Entry: 3rwv, 1.5 Å

PDB Description: crystal structure of apo-form of human glycolipid transfer protein at 1.5 a resolution

PDB Compounds: (B:) glycolipid transfer protein

SCOPe Domain Sequences for d3rwvb_:

Sequence; same for both SEQRES and ATOM records:

>d3rwvb_ a.224.1.1 (B:) Glycolipid transfer protein, GLTP {Human (Homo sapiens) [TaxId: 9606]}
allaehllkplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavyd
tnpakfrtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenhp
nlirvnatkayemalkkyhgwivqkifqaalyaapyksdflkalskgqnvteeeclekir
lflvnytatidviyemytqmnaelnykv

Timeline for d3rwvb_:

• d3rwvb_ first appeared in SCOPe 2.03
  
• d3rwvb_ appears in SCOPe 2.07