SCOPe 2.06: Domain d3rvwc2: 3rvw C:108-211

Lineage for d3rvwc2 (3rvw C:108-211)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (16 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (498 PDB entries)

8. Domain d3rvwc2: 3rvw C:108-211 [216100]
   Other proteins in same PDB: d3rvwc1
   automated match to d1eo8l2
   complexed with ca, edo, nag

Details for d3rvwc2

PDB Entry: 3rvw, 1.95 Å

PDB Description: crystal structure of der p 1 complexed with fab 4c1

PDB Compounds: (C:) 4C1 - light chain

SCOPe Domain Sequences for d3rvwc2:

Sequence; same for both SEQRES and ATOM records:

>d3rvwc2 b.1.1.2 (C:108-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

Timeline for d3rvwc2:

• d3rvwc2 first appeared in SCOPe 2.03
  
• d3rvwc2 appears in SCOPe 2.05
  
• d3rvwc2 appears in SCOPe 2.07
  
• d3rvwc2 appears in the current release, SCOPe 2.08