SCOPe 2.05: Domain d3rvuc2: 3rvu C:111-212

Lineage for d3rvuc2 (3rvu C:111-212)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (14 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (368 PDB entries)

8. Domain d3rvuc2: 3rvu C:111-212 [216096]
   Other proteins in same PDB: d3rvuc1
   automated match to d2fbjl2

Details for d3rvuc2

PDB Entry: 3rvu, 2.5 Å

PDB Description: structure of 4c1 fab in c2221 space group

PDB Compounds: (C:) 4C1 Fab - light chain

SCOPe Domain Sequences for d3rvuc2:

Sequence; same for both SEQRES and ATOM records:

>d3rvuc2 b.1.1.2 (C:111-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskd
stysmsstltltkdeyerhnsytceathktstspivksfnrn

Timeline for d3rvuc2:

• d3rvuc2 first appeared in SCOPe 2.03
  
• d3rvuc2 appears in SCOPe 2.04
  
• d3rvuc2 appears in SCOPe 2.06
  
• d3rvuc2 appears in the current release, SCOPe 2.08