Lineage for d3rvuc2 (3rvu C:111-212)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2752697Domain d3rvuc2: 3rvu C:111-212 [216096]
    Other proteins in same PDB: d3rvuc1, d3rvuc3
    automated match to d2fbjl2

Details for d3rvuc2

PDB Entry: 3rvu (more details), 2.5 Å

PDB Description: structure of 4c1 fab in c2221 space group
PDB Compounds: (C:) 4C1 Fab - light chain

SCOPe Domain Sequences for d3rvuc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rvuc2 b.1.1.2 (C:111-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskd
stysmsstltltkdeyerhnsytceathktstspivksfnrn

SCOPe Domain Coordinates for d3rvuc2:

Click to download the PDB-style file with coordinates for d3rvuc2.
(The format of our PDB-style files is described here.)

Timeline for d3rvuc2: