SCOPe 2.06: Domain d3rvsb1: 3rvs B:1-129

Lineage for d3rvsb1 (3rvs B:1-129)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.1: CheY-related [52173] (26 proteins)

6. Protein automated matches [190177] (7 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [189043] (17 PDB entries)

8. Domain d3rvsb1: 3rvs B:1-129 [216092]
   Other proteins in same PDB: d3rvsa2, d3rvsb2
   automated match to d3rvra_
   complexed with gol, mn, so4, wo4

Details for d3rvsb1

PDB Entry: 3rvs, 2.1 Å

PDB Description: structure of the cheyn59d/e89r tungstate complex

PDB Compounds: (B:) Chemotaxis protein cheY

SCOPe Domain Sequences for d3rvsb1:

Sequence; same for both SEQRES and ATOM records:

>d3rvsb1 c.23.1.1 (B:1-129) automated matches {Escherichia coli K-12 [TaxId: 83333]}
madkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwdm
pnmdglellktiradgamsalpvlmvtarakkeniiaaaqagasgyvvkpftaatleekl
nkifeklgm

Timeline for d3rvsb1:

• d3rvsb1 first appeared in SCOPe 2.03, called d3rvsb_
  
• d3rvsb1 was called d3rvsb_ in SCOPe 2.05
  
• d3rvsb1 appears in SCOPe 2.07
  
• d3rvsb1 appears in the current release, SCOPe 2.08