| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) ![]() |
| Family c.23.1.1: CheY-related [52173] (26 proteins) |
| Protein automated matches [190177] (9 species) not a true protein |
| Species Escherichia coli K-12 [TaxId:83333] [189043] (16 PDB entries) |
| Domain d3rvpb1: 3rvp B:1-129 [216090] Other proteins in same PDB: d3rvpa2, d3rvpb2 automated match to d3rvqa_ complexed with bef, gol, mg, mn, so4 |
PDB Entry: 3rvp (more details), 2.4 Å
SCOPe Domain Sequences for d3rvpb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rvpb1 c.23.1.1 (B:1-129) automated matches {Escherichia coli K-12 [TaxId: 83333]}
madkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwdm
pnmdglellktiradgamsalpvlmvtakakkeniiaaaqagasgyvvkpftaatleekl
nkifeklgm
Timeline for d3rvpb1: