SCOPe 2.08: Domain d3rvpa1: 3rvp A:1-129

Lineage for d3rvpa1 (3rvp A:1-129)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.1: CheY-related [52173] (26 proteins)

6. Protein automated matches [190177] (9 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [189043] (16 PDB entries)

8. Domain d3rvpa1: 3rvp A:1-129 [216089]
   Other proteins in same PDB: d3rvpa2, d3rvpb2
   automated match to d3rvqa_
   complexed with bef, gol, mg, mn, so4

Details for d3rvpa1

PDB Entry: 3rvp, 2.4 Å

PDB Description: structure of the chey-bef3 complex with substitutions at 59 and 89: n59d and e89k

PDB Compounds: (A:) Chemotaxis protein cheY

SCOPe Domain Sequences for d3rvpa1:

Sequence; same for both SEQRES and ATOM records:

>d3rvpa1 c.23.1.1 (A:1-129) automated matches {Escherichia coli K-12 [TaxId: 83333]}
madkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwdm
pnmdglellktiradgamsalpvlmvtakakkeniiaaaqagasgyvvkpftaatleekl
nkifeklgm

Timeline for d3rvpa1:

• d3rvpa1 first appeared in SCOPe 2.03, called d3rvpa_
  
• d3rvpa1 appears in SCOPe 2.07