Lineage for d3rvma_ (3rvm A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2855424Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2855425Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 2855710Protein automated matches [190177] (9 species)
    not a true protein
  7. 2855718Species Escherichia coli K-12 [TaxId:83333] [189043] (16 PDB entries)
  8. 2855721Domain d3rvma_: 3rvm A: [216087]
    automated match to d3rvra_
    complexed with mn

Details for d3rvma_

PDB Entry: 3rvm (more details), 1.45 Å

PDB Description: structure of the chey-mn2+ complex with substitutions at 59 and 89: n59d and e89r
PDB Compounds: (A:) Chemotaxis protein cheY

SCOPe Domain Sequences for d3rvma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rvma_ c.23.1.1 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
madkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwdm
pnmdglellktiradgamsalpvlmvtarakkeniiaaaqagasgyvvkpftaatleekl
nkifeklgm

SCOPe Domain Coordinates for d3rvma_:

Click to download the PDB-style file with coordinates for d3rvma_.
(The format of our PDB-style files is described here.)

Timeline for d3rvma_: