SCOPe 2.06: Domain d3rv5d_: 3rv5 D:

Lineage for d3rv5d_ (3rv5 D:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Troponin C [47503] (6 species)

7. Species Human (Homo sapiens), cardiac isoform [TaxId:9606] [47508] (17 PDB entries)

8. Domain d3rv5d_: 3rv5 D: [216081]
   automated match to d1mxlc_
   complexed with ca, cd, dxc

Details for d3rv5d_

PDB Entry: 3rv5, 2.2 Å

PDB Description: Crystal structure of human cardiac troponin C regulatory domain in complex with cadmium and deoxycholic acid

PDB Compounds: (D:) troponin c, slow skeletal and cardiac muscles

SCOPe Domain Sequences for d3rv5d_:

Sequence; same for both SEQRES and ATOM records:

>d3rv5d_ a.39.1.5 (D:) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]}
ykaaveqlteeqknefkaafdifvlgaedgcistkelgkvmrmlgqnptpeelqemidev
dedgsgtvdfdeflvmmv

Timeline for d3rv5d_:

• d3rv5d_ first appeared in SCOPe 2.03
  
• d3rv5d_ appears in SCOPe 2.05
  
• d3rv5d_ appears in SCOPe 2.07
  
• d3rv5d_ appears in the current release, SCOPe 2.08