| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
| Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
| Protein Troponin C [47503] (6 species) |
| Species Human (Homo sapiens), cardiac isoform [TaxId:9606] [47508] (28 PDB entries) |
| Domain d3rv5d_: 3rv5 D: [216081] automated match to d1mxlc_ complexed with ca, cd, dxc fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 3rv5 (more details), 2.2 Å
SCOPe Domain Sequences for d3rv5d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rv5d_ a.39.1.5 (D:) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]}
ykaaveqlteeqknefkaafdifvlgaedgcistkelgkvmrmlgqnptpeelqemidev
dedgsgtvdfdeflvmmv
Timeline for d3rv5d_: