![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.104: YjeF N-terminal domain-like [64152] (1 superfamily) 3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 32145678; strand 8 is antiparallel to the rest |
![]() | Superfamily c.104.1: YjeF N-terminal domain-like [64153] (2 families) ![]() possible circular permutation of the ribokinase-like fold (of the YjeF C-terminal domain) |
![]() | Family c.104.1.1: YjeF N-terminal domain-like [64154] (2 proteins) |
![]() | Protein Hypothetical protein TM0922, N-terminal domain [142716] (1 species) YjeF homolog |
![]() | Species Thermotoga maritima [TaxId:2336] [142717] (21 PDB entries) Uniprot Q9X024 1-211 |
![]() | Domain d3ru3a1: 3ru3 A:1-211 [216074] Other proteins in same PDB: d3ru3a2 automated match to d2ax3a2 complexed with atp, k, mg, ndp, npw |
PDB Entry: 3ru3 (more details), 2.6 Å
SCOPe Domain Sequences for d3ru3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ru3a1 c.104.1.1 (A:1-211) Hypothetical protein TM0922, N-terminal domain {Thermotoga maritima [TaxId: 2336]} mkeideltikeygvdsrilmeragisvvlameeelgnlsdyrflvlcgggnnggdgfvva rnllgvvkdvlvvflgkkktpdceynyglykkfggkvveqfepsilnefdvvvdaifgtg lrgeitgeyaeiinlvnksgkvvvsvdvpsgidsntgkvlrtavkadltvtfgvpkighi lfpgrdltgklkvanighpvhlinsinryvi
Timeline for d3ru3a1: