SCOPe 2.01: Domain d1fv1b1: 1fv1 B:93-190

Lineage for d1fv1b1 (1fv1 B:93-190)

Root: SCOPe 2.01
Class b: All beta proteins [48724] (174 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (39 PDB entries)
Uniprot P04229 30-219
probably orthologous to the mouse I-E group
Domain d1fv1b1: 1fv1 B:93-190 [21606]
Other proteins in same PDB: d1fv1a1, d1fv1a2, d1fv1b2, d1fv1d1, d1fv1d2, d1fv1e2
complexed with gol, so4

Details for d1fv1b1

PDB Entry: 1fv1 (more details), 1.9 Å

PDB Description: structural basis for the binding of an immunodominant peptide from myelin basic protein in different registers by two hla-dr2 alleles

PDB Compounds: (B:) major histocompatibility complex beta chain

SCOPe Domain Sequences for d1fv1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fv1b1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrvepkvtvypartqtlqhhnllvcsvngfypgsievrwfrnsqeekagvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewra

SCOPe Domain Coordinates for d1fv1b1:

Click to download the PDB-style file with coordinates for d1fv1b1.
(The format of our PDB-style files is described here.)

Timeline for d1fv1b1: