![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
![]() | Superfamily c.72.1: Ribokinase-like [53613] (6 families) ![]() has extra strand located between strands 2 and 3 |
![]() | Family c.72.1.4: YjeF C-terminal domain-like [75292] (3 proteins) automatically mapped to Pfam PF01256 |
![]() | Protein Hypothetical protein TM0922, C-terminal domain [142707] (1 species) YjeF homolog |
![]() | Species Thermotoga maritima [TaxId:2336] [142708] (21 PDB entries) Uniprot Q9X024 212-489 |
![]() | Domain d3rtea2: 3rte A:212-489 [216057] Other proteins in same PDB: d3rtea1 automated match to d2ax3a1 complexed with atp, k, mg, nap |
PDB Entry: 3rte (more details), 2.1 Å
SCOPe Domain Sequences for d3rtea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rtea2 c.72.1.4 (A:212-489) Hypothetical protein TM0922, C-terminal domain {Thermotoga maritima [TaxId: 2336]} tremvrsllperprdshkgtygkvliiagsrlysgapvlsgmgslkvgtglvklavpfpq nliatsrfpelisvpidtekgffslqnlqeclelskdvdvvaigpglgnnehvrefvnef lktlekpavidadainvldtsvlkerkspavltphpgemarlvkktvgdvkynyelaeef akendcvlvlksattivtdgektlfnitgntglskggsgdvltgmiagfiaqglspleas tvsvylhgfaaelfeqdergltasellrlipeairrlk
Timeline for d3rtea2: