Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
Superfamily c.72.1: Ribokinase-like [53613] (6 families) has extra strand located between strands 2 and 3 |
Family c.72.1.4: YjeF C-terminal domain-like [75292] (3 proteins) automatically mapped to Pfam PF01256 |
Protein Hypothetical protein TM0922, C-terminal domain [142707] (1 species) YjeF homolog |
Species Thermotoga maritima [TaxId:2336] [142708] (21 PDB entries) Uniprot Q9X024 212-489 |
Domain d3rtca2: 3rtc A:212-489 [216053] Other proteins in same PDB: d3rtca1 automated match to d2ax3a1 complexed with atp, k, mg, nad |
PDB Entry: 3rtc (more details), 2.1 Å
SCOPe Domain Sequences for d3rtca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rtca2 c.72.1.4 (A:212-489) Hypothetical protein TM0922, C-terminal domain {Thermotoga maritima [TaxId: 2336]} tremvrsllperprdshkgtygkvliiagsrlysgapvlsgmgslkvgtglvklavpfpq nliatsrfpelisvpidtekgffslqnlqeclelskdvdvvaigpglgnnehvrefvnef lktlekpavidadainvldtsvlkerkspavltphpgemarlvkktvgdvkynyelaeef akendcvlvlksattivtdgektlfnitgntglskggsgdvltgmiagfiaqglspleas tvsvylhgfaaelfeqdergltasellrlipeairrlk
Timeline for d3rtca2: