| Class b: All beta proteins [48724] (119 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
| Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (12 species) |
| Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [49134] (11 PDB entries) |
| Domain d1sebf1: 1seb F:93-192 [21604] Other proteins in same PDB: d1seba2, d1sebb2, d1sebd1, d1sebd2, d1sebe2, d1sebf2, d1sebh1, d1sebh2 |
PDB Entry: 1seb (more details), 2.7 Å
SCOP Domain Sequences for d1sebf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sebf1 b.1.1.2 (F:93-192) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR1}
rrvepkvtvypsktqplqhhnllvcsvsgfypgsievrwfrngqeekagvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewrars
Timeline for d1sebf1: