Lineage for d3rsqa1 (3rsq A:1-211)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919260Fold c.104: YjeF N-terminal domain-like [64152] (1 superfamily)
    3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 32145678; strand 8 is antiparallel to the rest
  4. 2919261Superfamily c.104.1: YjeF N-terminal domain-like [64153] (2 families) (S)
    possible circular permutation of the ribokinase-like fold (of the YjeF C-terminal domain)
  5. 2919262Family c.104.1.1: YjeF N-terminal domain-like [64154] (2 proteins)
  6. 2919263Protein Hypothetical protein TM0922, N-terminal domain [142716] (1 species)
    YjeF homolog
  7. 2919264Species Thermotoga maritima [TaxId:2336] [142717] (21 PDB entries)
    Uniprot Q9X024 1-211
  8. 2919268Domain d3rsqa1: 3rsq A:1-211 [216035]
    Other proteins in same PDB: d3rsqa2, d3rsqa3
    automated match to d2ax3a2
    complexed with k, nai, nax

Details for d3rsqa1

PDB Entry: 3rsq (more details), 2.05 Å

PDB Description: crystal structure of tm0922, a fusion of a domain of unknown function and adp/atp-dependent nad(p)h-hydrate dehydratase from thermotoga maritima soaked with nadh
PDB Compounds: (A:) Putative uncharacterized protein

SCOPe Domain Sequences for d3rsqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rsqa1 c.104.1.1 (A:1-211) Hypothetical protein TM0922, N-terminal domain {Thermotoga maritima [TaxId: 2336]}
mkeideltikeygvdsrilmeragisvvlameeelgnlsdyrflvlcgggnnggdgfvva
rnllgvvkdvlvvflgkkktpdceynyglykkfggkvveqfepsilnefdvvvdaifgtg
lrgeitgeyaeiinlvnksgkvvvsvdvpsgidsntgkvlrtavkadltvtfgvpkighi
lfpgrdltgklkvanighpvhlinsinryvi

SCOPe Domain Coordinates for d3rsqa1:

Click to download the PDB-style file with coordinates for d3rsqa1.
(The format of our PDB-style files is described here.)

Timeline for d3rsqa1: