SCOPe 2.03: Domain d3rs8a2: 3rs8 A:212-489

Lineage for d3rs8a2 (3rs8 A:212-489)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.72: Ribokinase-like [53612] (3 superfamilies)
   core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
   potential superfamily: members of this fold have similar functions but different ATP-binding sites

4. Superfamily c.72.1: Ribokinase-like [53613] (6 families)
   has extra strand located between strands 2 and 3

5. Family c.72.1.4: YjeF C-terminal domain-like [75292] (3 proteins)
   automatically mapped to Pfam PF01256

6. Protein Hypothetical protein TM0922, C-terminal domain [142707] (1 species)
   YjeF homolog

7. Species Thermotoga maritima [TaxId:2336] [142708] (21 PDB entries)
   Uniprot Q9X024 212-489

8. Domain d3rs8a2: 3rs8 A:212-489 [216028]
   Other proteins in same PDB: d3rs8a1
   automated match to d2ax3a1
   complexed with apr, gol, k, mg

Details for d3rs8a2

PDB Entry: 3rs8, 2.1 Å

PDB Description: crystal structure of tm0922, a fusion of a domain of unknown function and adp/atp-dependent nad(p)h-hydrate dehydratase from thermotoga maritima in complex with adp-ribose

PDB Compounds: (A:) Putative uncharacterized protein

SCOPe Domain Sequences for d3rs8a2:

Sequence; same for both SEQRES and ATOM records:

>d3rs8a2 c.72.1.4 (A:212-489) Hypothetical protein TM0922, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
tremvrsllperprdshkgtygkvliiagsrlysgapvlsgmgslkvgtglvklavpfpq
nliatsrfpelisvpidtekgffslqnlqeclelskdvdvvaigpglgnnehvrefvnef
lktlekpavidadainvldtsvlkerkspavltphpgemarlvkktvgdvkynyelaeef
akendcvlvlksattivtdgektlfnitgntglskggsgdvltgmiagfiaqglspleas
tvsvylhgfaaelfeqdergltasellrlipeairrlk

Timeline for d3rs8a2:

• d3rs8a2 is new in SCOPe 2.03-stable
  
• d3rs8a2 appears in SCOPe 2.04
  
• d3rs8a2 appears in the current release, SCOPe 2.08