Lineage for d3rrpb_ (3rrp B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010255Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 2010256Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. 2010426Family a.127.1.0: automated matches [191431] (1 protein)
    not a true family
  6. 2010427Protein automated matches [190621] (20 species)
    not a true protein
  7. 2010463Species Mycobacterium abscessus [TaxId:561007] [226126] (1 PDB entry)
  8. 2010465Domain d3rrpb_: 3rrp B: [216026]
    automated match to d1vdka_
    complexed with edo, lmr

Details for d3rrpb_

PDB Entry: 3rrp (more details), 2.3 Å

PDB Description: crystal structure of fumarate hydratase fum from mycobacterium abscessus with malate bound
PDB Compounds: (B:) Probable fumarate hydratase Fum

SCOPe Domain Sequences for d3rrpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rrpb_ a.127.1.0 (B:) automated matches {Mycobacterium abscessus [TaxId: 561007]}
qyriehdtmgevrvpaealwraqtqravenfpisgrglertqiralgllkgacaqvnkdl
gllaaekadaiiaaaqeiadgkhddqfpidvfqtgsgtssnmnaneviasiaaqatppvv
vhpnddvnmsqssndtfptathlaateaavrdlipaleylqqalatkakawktvvksgrt
hlmdavpvtlgqefggyarqieagiervkatlprlgelpiggtavgtglnapdgfgakvv
evlkqstglselktasdsfeaqaardglvegsgalktiaasltkiandirwmgsgpltgl
geiqlpdlqpgssimpgkvnpvlpeavtqvaaqvigndaaitvgglsgafelnvyipvma
rnllesftllanvsrlfvdkcvdglvanedhlrtlaesspsivtplnsaigyeeaaavak
ealkerktirqtvidrgligdklsieeldkrldvlamakv

SCOPe Domain Coordinates for d3rrpb_:

Click to download the PDB-style file with coordinates for d3rrpb_.
(The format of our PDB-style files is described here.)

Timeline for d3rrpb_: