SCOPe 2.05: Domain d3rrea1: 3rre A:1-211

Lineage for d3rrea1 (3rre A:1-211)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.104: YjeF N-terminal domain-like [64152] (1 superfamily)
   3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 32145678; strand 8 is antiparallel to the rest

4. Superfamily c.104.1: YjeF N-terminal domain-like [64153] (2 families)
   possible circular permutation of the ribokinase-like fold (of the YjeF C-terminal domain)

5. Family c.104.1.1: YjeF N-terminal domain-like [64154] (2 proteins)

6. Protein Hypothetical protein TM0922, N-terminal domain [142716] (1 species)
   YjeF homolog

7. Species Thermotoga maritima [TaxId:2336] [142717] (21 PDB entries)
   Uniprot Q9X024 1-211

8. Domain d3rrea1: 3rre A:1-211 [216013]
   Other proteins in same PDB: d3rrea2
   automated match to d2ax3a2
   complexed with adp, gol, k, mg

Details for d3rrea1

PDB Entry: 3rre, 2.15 Å

PDB Description: Crystal Structure of tm0922, a fusion of a domain of unknown function and ADP/ATP-dependent NAD(P)H-hydrate dehydratase from Thermotoga maritima in complex with ADP

PDB Compounds: (A:) Putative uncharacterized protein

SCOPe Domain Sequences for d3rrea1:

Sequence; same for both SEQRES and ATOM records:

>d3rrea1 c.104.1.1 (A:1-211) Hypothetical protein TM0922, N-terminal domain {Thermotoga maritima [TaxId: 2336]}
mkeideltikeygvdsrilmeragisvvlameeelgnlsdyrflvlcgggnnggdgfvva
rnllgvvkdvlvvflgkkktpdceynyglykkfggkvveqfepsilnefdvvvdaifgtg
lrgeitgeyaeiinlvnksgkvvvsvdvpsgidsntgkvlrtavkadltvtfgvpkighi
lfpgrdltgklkvanighpvhlinsinryvi

Timeline for d3rrea1:

• d3rrea1 first appeared in SCOPe 2.03
  
• d3rrea1 appears in SCOPe 2.04
  
• d3rrea1 appears in SCOPe 2.06
  
• d3rrea1 appears in the current release, SCOPe 2.08