Lineage for d3rr2a1 (3rr2 A:1-299)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2139769Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2139770Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2140083Family c.79.1.0: automated matches [191338] (1 protein)
    not a true family
  6. 2140084Protein automated matches [190215] (32 species)
    not a true protein
  7. 2140143Species Mycobacterium marinum [TaxId:216594] [226125] (1 PDB entry)
  8. 2140144Domain d3rr2a1: 3rr2 A:1-299 [216005]
    Other proteins in same PDB: d3rr2a2
    automated match to d1oasa_

Details for d3rr2a1

PDB Entry: 3rr2 (more details), 1.95 Å

PDB Description: structure of a cysteine synthase (o-acetylserine sulfhydrylase (oass)) from mycobacterium marinum atcc baa-535 / m
PDB Compounds: (A:) Cysteine synthase

SCOPe Domain Sequences for d3rr2a1:

Sequence, based on SEQRES records: (download)

>d3rr2a1 c.79.1.0 (A:1-299) automated matches {Mycobacterium marinum [TaxId: 216594]}
mtiaenitqliggtplvrlrrvtdgaaadvvaklesfnpagsikdrigvamidaaekagl
ikpdtiileptsgntgialamvsaargykcvltmpdtmsierrmllraygaelvltpgae
gmagaiakaeelaktddryfipqqfenpanpavhavttaeevwrdtdgkvdifvsgvgtg
gtitgvaqvikqrrpsaqfvavepaaspvlsggqkgphpiqgigagfvppvldlalvdev
itvgnddalelarrmateegllvgissgaavwaarelahrpenagklivvvlpdfgery

Sequence, based on observed residues (ATOM records): (download)

>d3rr2a1 c.79.1.0 (A:1-299) automated matches {Mycobacterium marinum [TaxId: 216594]}
mtiaenitqliggtplvrlrrvtdgaaadvvaklesfnpagsikdrigvamidaaekagl
ikpdtiileptsgntgialamvsaargykcvltmpdtmsierrmllraygaelvltpmag
aiakaeelaktddryfipqqfenpanpavhavttaeevwrdtdgkvdifvsgvgtggtit
gvaqvikqrrpsaqfvavepaaspvkgphpiqgigagfvppvldlalvdevitvgnddal
elarrmateegllvgissgaavwaarelahrpenagklivvvlpdfgery

SCOPe Domain Coordinates for d3rr2a1:

Click to download the PDB-style file with coordinates for d3rr2a1.
(The format of our PDB-style files is described here.)

Timeline for d3rr2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3rr2a2