![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
![]() | Superfamily c.72.1: Ribokinase-like [53613] (6 families) ![]() has extra strand located between strands 2 and 3 |
![]() | Family c.72.1.4: YjeF C-terminal domain-like [75292] (3 proteins) automatically mapped to Pfam PF01256 |
![]() | Protein automated matches [193682] (1 species) not a true protein |
![]() | Species Bacillus subtilis [TaxId:1423] [193683] (9 PDB entries) |
![]() | Domain d3rqxa1: 3rqx A:1-276 [216004] Other proteins in same PDB: d3rqxa2 automated match to d3rpha_ complexed with b4p, cl, mg |
PDB Entry: 3rqx (more details), 1.6 Å
SCOPe Domain Sequences for d3rqxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rqxa1 c.72.1.4 (A:1-276) automated matches {Bacillus subtilis [TaxId: 1423]} mnvpfwteehvratlperdaeshkgtygtalllagsddmpgaallaglgamrsglgklvi gtsenviplivpvlpeatywrdgwkkaadaqleetyraiaigpglpqtesvqqavdhvlt adcpvildagalakrtypkregpviltphpgeffrmtgvpvnelqkkraeyakewaaqlq tvivlkgnqtviafpdgdcwlnptgngalakggtgdtltgmilgmlcchedpkhavlnav ylhgacaelwtdehsahtllahelsdilprvwkrfe
Timeline for d3rqxa1: