SCOPe 2.04: Domain d3rqsa2: 3rqs A:216-314

Lineage for d3rqsa2 (3rqs A:216-314)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.0: automated matches [227147] (1 protein)
   not a true family

6. Protein automated matches [226851] (26 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225061] (13 PDB entries)

8. Domain d3rqsa2: 3rqs A:216-314 [216003]
   Other proteins in same PDB: d3rqsa1
   automated match to d1f17a1
   complexed with gol

Details for d3rqsa2

PDB Entry: 3rqs, 2 Å

PDB Description: Crystal Structure of human L-3- Hydroxyacyl-CoA dehydrogenase (EC1.1.1.35) from mitochondria at the resolution 2.0 A, Northeast Structural Genomics Consortium Target HR487, Mitochondrial Protein Partnership

PDB Compounds: (A:) Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial

SCOPe Domain Sequences for d3rqsa2:

Sequence; same for both SEQRES and ATOM records:

>d3rqsa2 a.100.1.0 (A:216-314) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gfivnrllvpylmeairlyergdaskedidtamklgagypmgpfelldyvgldttkfivd
gwhemdaenplhqpspslnklvaenkfgkktgegfykyk

Timeline for d3rqsa2:

• d3rqsa2 first appeared in SCOPe 2.03
  
• d3rqsa2 appears in SCOPe 2.05
  
• d3rqsa2 appears in the current release, SCOPe 2.08