| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) ![]() N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
| Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
| Protein automated matches [226851] (46 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [225061] (28 PDB entries) |
| Domain d3rqsa2: 3rqs A:216-314 [216003] Other proteins in same PDB: d3rqsa1 automated match to d1f17a1 complexed with gol |
PDB Entry: 3rqs (more details), 2 Å
SCOPe Domain Sequences for d3rqsa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rqsa2 a.100.1.0 (A:216-314) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gfivnrllvpylmeairlyergdaskedidtamklgagypmgpfelldyvgldttkfivd
gwhemdaenplhqpspslnklvaenkfgkktgegfykyk
Timeline for d3rqsa2: