Lineage for d3rqsa2 (3rqs A:216-314)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2721323Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2721324Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2721533Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2721534Protein automated matches [226851] (46 species)
    not a true protein
  7. 2721650Species Human (Homo sapiens) [TaxId:9606] [225061] (28 PDB entries)
  8. 2721651Domain d3rqsa2: 3rqs A:216-314 [216003]
    Other proteins in same PDB: d3rqsa1
    automated match to d1f17a1
    complexed with gol

Details for d3rqsa2

PDB Entry: 3rqs (more details), 2 Å

PDB Description: Crystal Structure of human L-3- Hydroxyacyl-CoA dehydrogenase (EC1.1.1.35) from mitochondria at the resolution 2.0 A, Northeast Structural Genomics Consortium Target HR487, Mitochondrial Protein Partnership
PDB Compounds: (A:) Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial

SCOPe Domain Sequences for d3rqsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rqsa2 a.100.1.0 (A:216-314) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gfivnrllvpylmeairlyergdaskedidtamklgagypmgpfelldyvgldttkfivd
gwhemdaenplhqpspslnklvaenkfgkktgegfykyk

SCOPe Domain Coordinates for d3rqsa2:

Click to download the PDB-style file with coordinates for d3rqsa2.
(The format of our PDB-style files is described here.)

Timeline for d3rqsa2: