| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (19 proteins) the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest C-terminal domains also show some similarity |
| Protein automated matches [226987] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [226137] (1 PDB entry) |
| Domain d3rqsa1: 3rqs A:23-215 [216002] Other proteins in same PDB: d3rqsa2 automated match to d1f17a2 complexed with gol |
PDB Entry: 3rqs (more details), 2 Å
SCOPe Domain Sequences for d3rqsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rqsa1 c.2.1.6 (A:23-215) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kkiivkhvtviggglmgagiaqvaaatghtvvlvdqtedilakskkgieeslrkvakkkf
aenpkagdefvektlstiatstdaasvvhstdlvveaivenlkvknelfkrldkfaaeht
ifasntsslqitsianattrqdrfaglhffnpvpvmklveviktpmtsqktfeslvdfsk
algkhpvsckdtp
Timeline for d3rqsa1: