![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein Class II MHC beta chain, C-terminal domain [88625] (6 species) |
![]() | Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (41 PDB entries) Uniprot P04229 30-219 probably orthologous to the mouse I-E group |
![]() | Domain d1dlhe1: 1dlh E:93-190 [21600] Other proteins in same PDB: d1dlha1, d1dlha2, d1dlhb2, d1dlhd1, d1dlhd2, d1dlhe2 complexed with nag, ndg |
PDB Entry: 1dlh (more details), 2.8 Å
SCOPe Domain Sequences for d1dlhe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dlhe1 b.1.1.2 (E:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]} rrvepkvtvypsktqplqhhnllvcsvsgfypgsievrwfrngqeekagvvstgliqngd wtfqtlvmletvprsgevytcqvehpsvtspltvewra
Timeline for d1dlhe1: