Lineage for d1dlhe1 (1dlh E:93-190)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1292026Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
  7. 1292034Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (41 PDB entries)
    Uniprot P04229 30-219
    probably orthologous to the mouse I-E group
  8. 1292078Domain d1dlhe1: 1dlh E:93-190 [21600]
    Other proteins in same PDB: d1dlha1, d1dlha2, d1dlhb2, d1dlhd1, d1dlhd2, d1dlhe2
    complexed with nag, ndg

Details for d1dlhe1

PDB Entry: 1dlh (more details), 2.8 Å

PDB Description: crystal structure of the human class ii mhc protein hla-dr1 complexed with an influenza virus peptide
PDB Compounds: (E:) class II histocompatibility antigen (hla-dr1) (beta chain)

SCOPe Domain Sequences for d1dlhe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dlhe1 b.1.1.2 (E:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrvepkvtvypsktqplqhhnllvcsvsgfypgsievrwfrngqeekagvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewra

SCOPe Domain Coordinates for d1dlhe1:

Click to download the PDB-style file with coordinates for d1dlhe1.
(The format of our PDB-style files is described here.)

Timeline for d1dlhe1: