SCOPe 2.03: Domain d3rqha_: 3rqh A:

Lineage for d3rqha_ (3rqh A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.72: Ribokinase-like [53612] (3 superfamilies)
   core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
   potential superfamily: members of this fold have similar functions but different ATP-binding sites

4. Superfamily c.72.1: Ribokinase-like [53613] (6 families)
   has extra strand located between strands 2 and 3

5. Family c.72.1.4: YjeF C-terminal domain-like [75292] (3 proteins)
   automatically mapped to Pfam PF01256

6. Protein automated matches [193682] (1 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [193683] (9 PDB entries)

8. Domain d3rqha_: 3rqh A: [215989]
   automated match to d3rpha_
   complexed with b6p, mg

Details for d3rqha_

PDB Entry: 3rqh, 1.75 Å

PDB Description: crystal structure of adp/atp-dependent nad(p)h-hydrate dehydratase from bacillus subtilis in complex with p1,p6-di(adenosine-5') hexaphosphate

PDB Compounds: (A:) ADP/ATP-dependent NAD(P)H-hydrate dehydratase

SCOPe Domain Sequences for d3rqha_:

Sequence; same for both SEQRES and ATOM records:

>d3rqha_ c.72.1.4 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
amnvpfwteehvratlperdaeshkgtygtalllagsddmpgaallaglgamrsglgklv
igtsenviplivpvlpeatywrdgwkkaadaqleetyraiaigpglpqtesvqqavdhvl
tadcpvildagalakrtypkregpviltphpgeffrmtgvpvnelqkkraeyakewaaql
qtvivlkgnqtviafpdgdcwlnptgngalakggtgdtltgmilgmlcchedpkhavlna
vylhgacaelwtdehsahtllahelsdilprvwkrfe

Timeline for d3rqha_:

• d3rqha_ is new in SCOPe 2.03-stable
  
• d3rqha_ appears in SCOPe 2.04
  
• d3rqha_ appears in the current release, SCOPe 2.08, called d3rqha1