SCOPe 2.07: Domain d3rpqb2: 3rpq B:138-208

Lineage for d3rpqb2 (3rpq B:138-208)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (87 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [225713] (14 PDB entries)

8. Domain d3rpqb2: 3rpq B:138-208 [215980]
   Other proteins in same PDB: d3rpqa1, d3rpqb1
   automated match to d1i5za1
   complexed with cmp, po4

Details for d3rpqb2

PDB Entry: 3rpq, 2.61 Å

PDB Description: domain-domain flexibility leads to allostery within the camp receptor protein (crp)

PDB Compounds: (B:) Catabolite gene activator

SCOPe Domain Sequences for d3rpqb2:

Sequence; same for both SEQRES and ATOM records:

>d3rpqb2 a.4.5.0 (B:138-208) automated matches {Escherichia coli K-12 [TaxId: 83333]}
dvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilkmledqnlis
ahgktivvygt

Timeline for d3rpqb2:

• d3rpqb2 first appeared in SCOPe 2.03
  
• d3rpqb2 appears in SCOPe 2.06
  
• d3rpqb2 appears in the current release, SCOPe 2.08