SCOPe 2.08: Domain d3rpqa2: 3rpq A:138-207

Lineage for d3rpqa2 (3rpq A:138-207)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (92 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [225713] (14 PDB entries)

8. Domain d3rpqa2: 3rpq A:138-207 [215978]
   Other proteins in same PDB: d3rpqa1, d3rpqb1
   automated match to d1i5za1
   complexed with cmp, po4

Details for d3rpqa2

PDB Entry: 3rpq, 2.61 Å

PDB Description: domain-domain flexibility leads to allostery within the camp receptor protein (crp)

PDB Compounds: (A:) Catabolite gene activator

SCOPe Domain Sequences for d3rpqa2:

Sequence; same for both SEQRES and ATOM records:

>d3rpqa2 a.4.5.0 (A:138-207) automated matches {Escherichia coli K-12 [TaxId: 83333]}
dvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilkmledqnlis
ahgktivvyg

Timeline for d3rpqa2:

• d3rpqa2 first appeared in SCOPe 2.03
  
• d3rpqa2 appears in SCOPe 2.07