Lineage for d3rppb_ (3rpp B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878376Family c.47.1.13: DsbA-like [100953] (4 proteins)
    contains an all-alpha subdomain insertion
  6. 2878773Protein automated matches [190208] (8 species)
    not a true protein
  7. 2878780Species Human (Homo sapiens) [TaxId:9606] [188162] (3 PDB entries)
  8. 2878782Domain d3rppb_: 3rpp B: [215975]
    automated match to d3rpnd_

Details for d3rppb_

PDB Entry: 3rpp (more details), 1.8 Å

PDB Description: crystal structure of human kappa class glutathione transferase in apo form
PDB Compounds: (B:) Glutathione S-transferase kappa 1

SCOPe Domain Sequences for d3rppb_:

Sequence, based on SEQRES records: (download)

>d3rppb_ c.47.1.13 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gplprtvelfydvlspyswlgfeilcryqniwninlqlrpslitgimkdsgnkppgllpr
kglymandlkllrhhlqipihfpkdflsvmlekgslsamrfltavnlehpemlekasrel
wmrvwsrneditepqsilaaaekagmsaeqaqgllekiatpkvknqlketteaacrygaf
glpitvahvdgqthmlfgsdrmellahllgekwmgpippa

Sequence, based on observed residues (ATOM records): (download)

>d3rppb_ c.47.1.13 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gplprtvelfydvlspyswlgfeilcryqniwninlqlrpslitgimknkppgllprkgl
ymandlkllrhhlqipihfpkdflsvmlekgslsamrfltavnlehpemlekasrelwmr
vwsrneditepqsilaaaekagmsaeqaqgllekiatpkvknqlketteaacrygafglp
itvahvdgqthmlfgsdrmellahllgekwmgpippa

SCOPe Domain Coordinates for d3rppb_:

Click to download the PDB-style file with coordinates for d3rppb_.
(The format of our PDB-style files is described here.)

Timeline for d3rppb_: