Lineage for d3rpil2 (3rpi L:97-202)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2751496Domain d3rpil2: 3rpi L:97-202 [215972]
    Other proteins in same PDB: d3rpia_, d3rpib1, d3rpih_, d3rpil1
    automated match to d1rhha2
    complexed with nag

Details for d3rpil2

PDB Entry: 3rpi (more details), 2.65 Å

PDB Description: crystal structure of fab from 3bnc60, highly potent anti-hiv antibody
PDB Compounds: (L:) Light chain from highly potent anti-HIV neutralizing antibody

SCOPe Domain Sequences for d3rpil2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rpil2 b.1.1.2 (L:97-202) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d3rpil2:

Click to download the PDB-style file with coordinates for d3rpil2.
(The format of our PDB-style files is described here.)

Timeline for d3rpil2: